PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.3612s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 333aa    MW: 36881.6 Da    PI: 8.3711
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.3612s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.75.6e-2573116144
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                             d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e
  SapurV1A.3612s0010.1.p  73 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE 116
                             79***************************************986 PP

2QLQ59.87.6e-211246236
                     QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                            +FTa+Q+++L++Q+l+yKy+++++PvPpeLl  ++
  SapurV1A.3612s0010.1.p 12 PFTATQWHELEHQALIYKYMVSGVPVPPELLYSVK 46
                            8*****************************97775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.5E-131147IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.8E-151245IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.6541247IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.06473117IPR014977WRC domain
PfamPF088793.0E-2174116IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MLSAASARDG FPFTATQWHE LEHQALIYKY MVSGVPVPPE LLYSVKRSLE SSLASRLFPH  60
QPTGWGCFGR KADPEPGRCR RTDGKKWRCS KEAYPDSKYC ERHMHRGRNR SRKPVELAST  120
ATTAAAAPAI PLASMNRNLY NSTVSPSSSS FSHLSSSLES EMYAHQNSTR STFLYPHSSS  180
SGPHAGSGFS PQNSTTHNLF LDCGSSPRVD KEYRYSHGIR EDVDERAFFS DALGSARGVQ  240
DSYNQSSFKG YSQAQFQSFA ANTSKQEQQQ PGHHCFSLGT DIIKSSAAGS IKLEKEPETQ  300
KPLHHFFGEW KPKDADSWLD LASSSRTHEA DD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2175881e-145AC217588.1 Populus trichocarpa clone POP047-P10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011036429.10.0PREDICTED: growth-regulating factor 5-like
SwissprotQ8L8A62e-63GRF5_ARATH; Growth-regulating factor 5
TrEMBLB9GW170.0B9GW17_POPTR; Uncharacterized protein
STRINGPOPTR_0003s06360.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF97443137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.14e-61growth-regulating factor 5